- WIPF3 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-84388
- CR16
- WIPF3
- 0.1 ml (also 25ul)
- Rabbit
- Unconjugated
- Human
- Immunohistochemistry, Immunohistochemistry-Paraffin
- PBS (pH 7.2) and 40% Glycerol
- This antibody was developed against Recombinant Protein corresponding to amino acids: QIESSKGTNK EGGGSANTRG ASTPPTLGDL FAGGFPVLRP AGQRDVAGGK TGQGPGSRAP SPRLPNKTIS GPLIPPASPR LGNTS
- WAS/WASL interacting protein family member 3
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
QIESSKGTNKEGGGSANTRGASTPPTLGDLFAGGFPVLRPAGQRDVAGGKTGQGPGSRAPSPRLPNKTISGPLIPPASPRLGNTS
Specifications/Features
Available conjugates: Unconjugated